PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2NG392300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 881aa    MW: 94205.3 Da    PI: 10.7438
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2NG392300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox681.2e-21133188156
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          +++ +++t++q++eLe++F+++++p++++r eL+k+l+L+ rqVk+WFqNrR+++k
  Pavir.2NG392300.1.p 133 KKRYHRHTPQQIQELEAVFKECPHPDEKQRMELSKRLNLESRQVKFWFQNRRTQMK 188
                          688999***********************************************999 PP

2START170.88.9e-543515814205
                          HHHHHHHHHHHHHC-TT-EEEE.......EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.... CS
                START   4 eeaaqelvkkalaeepgWvkss.......esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla.... 77 
                          ++a++el+k a+ +ep+W  s+       e +n de+++ f++  +     +  ea r+ gv +  +++lv +l+d + +W+e+++    
  Pavir.2NG392300.1.p 351 LAAMEELMKVAQMDEPLWLPSAdggggglETLNFDEYRRAFARVLGpspagYVAEATREAGVAITSSVDLVDSLMDAA-RWSEMFPciva 439
                          789**************************************886669*******************************.*********** PP

                          EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--........-TTSEE-EESSEEEE CS
                START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.......sssvvRaellpSgil 153
                          +a+t++ issg      g +qlm aelq+lsplvp R++vf+R+++q+ +g w++vdvSvd   +p          ++++ ++llp+g+l
  Pavir.2NG392300.1.p 440 RASTTDIISSGmggtrsGSIQLMHAELQVLSPLVPiREVVFLRFCKQHAEGLWAVVDVSVDAVGNPHHhalngggAAGYMGCRLLPTGCL 529
                          *************************************************************9999987777778889************* PP

                          EEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                START 154 iepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                          ++++ ng+skvtwv h++++++ +h+l+r+l++sg+a ga++w+a lqrqc+
  Pavir.2NG392300.1.p 530 VQDMNNGYSKVTWVVHAEYDEAAVHQLYRPLLRSGQALGARRWLASLQRQCQ 581
                          ***************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.85E-22115189IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-23120189IPR009057Homeodomain-like
PROSITE profilePS5007118.107130190IPR001356Homeobox domain
SMARTSM003891.1E-19131194IPR001356Homeobox domain
PfamPF000464.1E-19133188IPR001356Homeobox domain
CDDcd000867.75E-20133190No hitNo description
PROSITE patternPS000270165188IPR017970Homeobox, conserved site
PROSITE profilePS5084841.168339585IPR002913START domain
CDDcd088752.09E-103343581No hitNo description
SuperFamilySSF559614.67E-27343581No hitNo description
SMARTSM002349.6E-42348582IPR002913START domain
PfamPF018521.6E-45351581IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 881 aa     Download sequence    Send to blast
MSFGGMFDGA AGSGVFSYDA GGGGGGGGGG GGGSGAGMHN HGRLIPAPPL PKPGGFGAPG  60
LSLGLQTNMD GGQLGDMSRM GFMGGSGSGS AGEGDSLGRG REDENDSRSG SDNVDGASGD  120
ELDPDNSNPR KKKKRYHRHT PQQIQELEAV FKECPHPDEK QRMELSKRLN LESRQVKFWF  180
QNRRTQMKTH IERHENALLR QENDKLRAEN MTIREAMRNP ICANCGGAAV LGEVSLEEQH  240
LRIENARLKD ELDRVCALAG KFLGRPISSG STMASLPGCS GLELAVGSNG FGLGPLGASA  300
LQPLPDLMGG GLPGPVGSAA MRLPAGIGAL DGAMHGPGDG VDRAVLLELG LAAMEELMKV  360
AQMDEPLWLP SADGGGGGLE TLNFDEYRRA FARVLGPSPA GYVAEATREA GVAITSSVDL  420
VDSLMDAARW SEMFPCIVAR ASTTDIISSG MGGTRSGSIQ LMHAELQVLS PLVPIREVVF  480
LRFCKQHAEG LWAVVDVSVD AVGNPHHHAL NGGGAAGYMG CRLLPTGCLV QDMNNGYSKV  540
TWVVHAEYDE AAVHQLYRPL LRSGQALGAR RWLASLQRQC QYLAILCSNS LPARDHAAVN  600
GHGWRSDNAG GAEEHAEAGA ADDGQLLRGR VRVGGAEVAA PRRVARRRRW RGSRERRRRR  660
HRGRGRGEGA HDGAAERGRA RGGPRRGVER HNLRAPAVHA PAARVRLPPR RAAPRGVGHP  720
RQRRGHAGDG PHRQGPAPRQ RRLPPPPKCN EWQPEQHADL ARDLHRPLRL AGGVRAGGRA  780
VHARGHERRR LRVRLPPPLR LRHPPGRPQP AVERRPGLAG RPIVHRRVPG HRGVPDPGEQ  840
PAHREAHRGV GGHRQQPAHL HHPEDQVRPP GQHRHSLAGI *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1129134RKKKKR
2645659RRRRWRGSRERRRRR
3655665RRRRRHRGRGR
4732741RQGPAPRQRR
5787794RRRLRVRL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.180680.0leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ2509850.0AJ250985.1 Zea mays mRNA for OCL3 protein (ocl3 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002462701.10.0hypothetical protein SORBIDRAFT_02g030470
SwissprotQ7Y0V70.0ROC6_ORYSJ; Homeobox-leucine zipper protein ROC6
TrEMBLC5X6400.0C5X640_SORBI; Putative uncharacterized protein Sb02g030470
STRINGSb02g030470.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.20.0HD-ZIP family protein